Protein Info for BT0142 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF02368: Big_2" amino acids 70 to 108 (39 residues), 25.7 bits, see alignment 9.1e-10 amino acids 134 to 199 (66 residues), 42.3 bits, see alignment E=6.2e-15 amino acids 237 to 275 (39 residues), 29.7 bits, see alignment 5e-11 PF16351: DUF4979" amino acids 311 to 451 (141 residues), 86.5 bits, see alignment E=2.4e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0142)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ABG8 at UniProt or InterPro

Protein Sequence (461 amino acids)

>BT0142 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKHIAFLSVKWMSVGLGMLSLLLSVASCGDKEYGDAMNEAQLMNDIEVNVGSSLPLAVGM
DFVLDYKPVPENVTNPEITLTSSDENVVSVSQDGRVTAKMIGKAYINLSQSTAFETLKTI
EVQVMPVATAIELENVELFEGTNKKVIVNVTPSDGYNVFDWKSDNEEVATVADDGTITGK
KPGTANISVSSQDGSQLTATAVVTVKEVIPIDKITLSEPGYDMMIGDKTLINCLLEPIDA
SVGLLSWSTTNDRVATVDADGLVTAVGAGEAEIIAQDPLSGLSASIAVKVVGEGVVSLSL
SYVRNQDELKALGWGFGQTPASVNFDAEGMTVNMSLQSNSKYRADLKMASNDRPVVLNIG
TYRYLAFRMDVPGNGSLKLDTNKGDYGNNPTGVLAEDSQVIYYDLQAKPYFPTDAPSDKL
TTFQLKIADVTVQPYSYKVYWVRTFKTLEDLKVYVEKENNK