Protein Info for BT0102 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details PF14293: YWFCY" amino acids 5 to 149 (145 residues), 164.5 bits, see alignment E=3.1e-52 PF02534: T4SS-DNA_transf" amino acids 159 to 573 (415 residues), 53.9 bits, see alignment E=2.9e-18 PF10412: TrwB_AAD_bind" amino acids 433 to 575 (143 residues), 42.5 bits, see alignment E=8.3e-15 PF12696: TraG-D_C" amino acids 460 to 572 (113 residues), 55.9 bits, see alignment E=8.4e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0102)

Predicted SEED Role

"Putative mobilization protein BF0133" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ABK8 at UniProt or InterPro

Protein Sequence (669 amino acids)

>BT0102 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MQNEDDLRGLAKVMDFMRAISILFVVINIYWFCYQSFRQWGINIGVVDKILLNFQRTAGL
FSNILYTKLFSVVFLALSCLGTKGVKEEKITWNKIYVFLTIGFILFFLNWWLLVLPLPLA
ANTALYIFTMTAGYLSLLAAGVWISRLLKNNLLDDVFNLENESFAQETRLIENEYSVNLR
SRFYYKKKWNDGWINVVAIFRACIVVGNPGSGKSFCVVNQFIKQQIEKGFAMYLYDYKFP
DLSEIAYNHLLNHSDGYKVKPKFYIINFDDPRKSHRCNPINPAFMTDISDAYEASYTIML
NLNRSWITKQGDFFVESPIILLASIIWFLKIYQGGKYCTFPHAIEFLNKKYADTFTILTS
YPELENYLSPFMDAWESNAQDQLQGQLASAKIPLSRMISPALYWVMTGDDFSLDINNPEE
PKILVVGNNPDRQNIYSCALGLYNSRIVKLINKKHQLKCSVIIDELPTIYFRGLDNLIAT
ARSNKVAVCLGFQDFSQLRRDYGDKESKVIENTVGNIFSGQVVSETAKTLSDRFGKVLQK
RQSMTINRNDKSTSISTQMDSLIPPSKISNLTQGMFVGAVSDNFDERIEQKIFHAEIVVD
NEQVKRETANYKKLPQIIDFRDEDGNDRMQEEIQANYNRVKQEVQQIVTDEMERIKNDPN
LQHLIKTEE