Protein Info for BT0056 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative glycosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 65 to 81 (17 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 290 to 307 (18 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 67 to 209 (143 residues), 73.5 bits, see alignment E=9.9e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0056)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ABQ4 at UniProt or InterPro

Protein Sequence (340 amino acids)

>BT0056 putative glycosyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MFIERLVALLLLFAGEFAYLRIADRFNIIDRPNQRSSHKKNVLRGGGIIFLLGVWMYAFL
NTTGYPLFIGGMTLIASVAFIDDVCSLSPRFRFFVQFVAMFLLLQEAGMLVENKVWFLLP
TMILGVCIINAYNFMDGINGMTGAFSLMVLFTFWLLNREMAFIDATLIELLMISALVFCF
FNFRNQAICFAGDVGSVGMAYCVIFILLKLVLFTGNVTYLLFLVVYGIDTVLTIFHRLLL
HENLLQPHRKHLFQLLANEGGHSHVTVSITYVLLQLAISLGYIYLPIDKWLYSVIVTIGL
VTAYLIIERKLYPKHKEYLKSLSCAVMDEGYSEKCLRNEN