Protein Info for BT0055 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative glycosyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 PF13579: Glyco_trans_4_4" amino acids 14 to 168 (155 residues), 45.3 bits, see alignment E=3.1e-15 PF13439: Glyco_transf_4" amino acids 14 to 168 (155 residues), 55.7 bits, see alignment E=1.6e-18 PF13477: Glyco_trans_4_2" amino acids 22 to 145 (124 residues), 29.5 bits, see alignment E=2e-10 PF00534: Glycos_transf_1" amino acids 184 to 345 (162 residues), 130.5 bits, see alignment E=1.2e-41 PF13692: Glyco_trans_1_4" amino acids 190 to 329 (140 residues), 103.9 bits, see alignment E=2.3e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0055)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ABQ5 at UniProt or InterPro

Protein Sequence (371 amino acids)

>BT0055 putative glycosyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKILHLGKFYPLKGGMEKAILDIVRGISMQGVTCDLLCVSTEKAGVFPLNEHAHIYAMPS
VCNVNSVRISPLLIPTLRKLCPNYDIIHIHCPNPMANLALYLSGYRGKVVLHWHSDILKQ
KYALKLYKPLQTWLIRRADVIIGTSPVYLENSPFLRGMEHKFRIVPLGCEAIVPSADRVS
DIRKQYKGKRIIFALGRLIAYKGFRFLIEAARYLDDGYVVLIGGTGPLYNKLLKQINEEN
LQGKVCLLGYVTDDEVAQYYGACDVFCLSSVWKTEAFGLVQIEAMSCGKPVVATNIEGSG
VPWVNRNGYSGLNVEPENPEALAKAIMKITSSEEAYRTYSRQARAHYNKMFVKERMLAGY
EQVYASLYHEK