Protein Info for DVUA0143 in Desulfovibrio vulgaris Hildenborough JW710

Name: nifA-2
Annotation: nif-specific regulatory protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 PF13185: GAF_2" amino acids 24 to 165 (142 residues), 63.2 bits, see alignment E=1.7e-20 PF13492: GAF_3" amino acids 26 to 165 (140 residues), 30.5 bits, see alignment E=2.3e-10 PF01590: GAF" amino acids 26 to 163 (138 residues), 69.2 bits, see alignment E=3e-22 PF00158: Sigma54_activat" amino acids 197 to 363 (167 residues), 240.8 bits, see alignment E=3.6e-75 PF14532: Sigma54_activ_2" amino acids 198 to 368 (171 residues), 78.9 bits, see alignment E=2.4e-25 PF13191: AAA_16" amino acids 198 to 316 (119 residues), 33.5 bits, see alignment E=3.3e-11 PF01078: Mg_chelatase" amino acids 215 to 339 (125 residues), 21.6 bits, see alignment E=6.9e-08 PF07724: AAA_2" amino acids 219 to 346 (128 residues), 29.4 bits, see alignment E=4.4e-10 PF07728: AAA_5" amino acids 221 to 339 (119 residues), 35.9 bits, see alignment E=4e-12 PF00004: AAA" amino acids 221 to 339 (119 residues), 31.5 bits, see alignment E=1.2e-10 PF02954: HTH_8" amino acids 461 to 502 (42 residues), 45.9 bits, see alignment 2.1e-15

Best Hits

KEGG orthology group: K02584, Nif-specific regulatory protein (inferred from 100% identity to dvl:Dvul_2966)

Predicted SEED Role

"Nitrogenase (molybdenum-iron)-specific transcriptional regulator NifA" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WE6 at UniProt or InterPro

Protein Sequence (515 amino acids)

>DVUA0143 nif-specific regulatory protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTCTVHALKLKALRAISNVIDRALQLEDALTETLRVLAETLAMQRGTITLLDGETGQLVI
AASHGLSREEQERGVYRLDEGVTGTIFSTGRPYLVRDVRNDPLFLDRTGARRVERGKVSF
LGVPILSKGRPVGVLNVDRLFGDAVSCAEDIEFLEVVATLVAQFLSLNEQVAARERALRR
ENMQLRTRVLDSRGDFIVGRSGAMAEVQRYIQRVAGTRATVLLLGESGVGKTLIARLVHT
LSEREHHPFIKVNCASIPESLLEAELFGHEKGAFTGAVSARMGRFEEAHEGTVFLDEIGE
LPPGIQAKLLRVLQEREFERLGSNRTRRVNVRIVAATNRDLAAQVDAGRFRQDLYYRLCV
FPIRVPPLRERPEDITGLLNHFLAKVARDYGRSLVLAPDALELLQRYAWPGNVREMENLI
ERMAILTDGTLADRRFVESLLEQAPAGDDGQMRAGLAVPPSLREVEQGELLAALRRNGWI
QHKAARELGLTPRQMGYRIRQWGLAPLVASERAKG