Protein Info for DVUA0007 in Desulfovibrio vulgaris Hildenborough JW710

Name: nifB
Annotation: nitrogenase cofactor biosynthesis protein NifB (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF04055: Radical_SAM" amino acids 27 to 209 (183 residues), 57.1 bits, see alignment E=2.6e-19 PF02579: Nitro_FeMo-Co" amino acids 424 to 487 (64 residues), 31.6 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: K02585, nitrogen fixation protein NifB (inferred from 100% identity to dvu:DVUA0007)

Predicted SEED Role

"Nitrogenase FeMo-cofactor synthesis FeS core scaffold and assembly protein NifB" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WT2 at UniProt or InterPro

Protein Sequence (514 amino acids)

>DVUA0007 nitrogenase cofactor biosynthesis protein NifB (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPCTPDTTSHPCFTEKAAQSCGRVHLPVAPKCNVLCGYCNRKYDCVNESRPGVTSGVLTP
AQAADYLDRVLEREPAIRVAGIAGPGDPMANAAATLETLRLIRQRHPDMLFCLSSNGLGM
PPHLDALAANGVTHATLTINAVDPDISARLYTWVRDGKVVWRGRPAAELMLERQLTALTG
LVQRGIVVKVNTILVPGINDGHVEQVAEKVAALGATLMNIIPLHPTHDTPLAQVAEPSPE
AVGEARRLAGAHIRQMTHCRRCRADAVGLLHHDRSRELAPLLRECAQKDDGAGARPFVAV
ATREGMLVNQHLGEATRLQIWGLGPARSGKGGTTTGGEAASGRNDAKGTGSGDVPGSTGG
NSWGKAGATPWDSEEDKNDKRTDSTGSTGGDSGAVCGTTHGTTCGKDATRAGTDATDMPV
PVLLEERATPRPGCGPERWHALADMLKDCRAVLTAACGESPRAILREHGITVTECAGIVE
DVVGAVLAGLDVNAFRARKGGVSKGCCRGGGDGC