Protein Info for DVUA0014 in Desulfovibrio vulgaris Hildenborough JW710

Name: glnB-3
Annotation: nitrogen regulatory protein P-II (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF00543: P-II" amino acids 1 to 105 (105 residues), 103.6 bits, see alignment E=3.8e-34

Best Hits

Swiss-Prot: 56% identical to GLNB1_METTM: Nitrogen fixation nifHD region GlnB-like protein 1 (glnBA) from Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)

KEGG orthology group: K02589, nitrogen regulatory protein PII 1 (inferred from 100% identity to dvl:Dvul_3091)

Predicted SEED Role

"Nitrogen regulatory protein P-II" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WS5 at UniProt or InterPro

Protein Sequence (108 amino acids)

>DVUA0014 nitrogen regulatory protein P-II (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIMIKAIVRPEKSSTVMQALFEAGYPAVTKLEVAGRGKQRGLKFGEVVYDELPKEMLITV
VPDADREYVLKAIMESARTGTKGSFGDGKIFVTPVEEVYTISSGVRES