Protein Info for DVUA0015 in Desulfovibrio vulgaris Hildenborough JW710

Name: nifH
Annotation: nitrogenase iron protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR01287: nitrogenase iron protein" amino acids 2 to 275 (274 residues), 448.3 bits, see alignment E=4.6e-139 PF00142: Fer4_NifH" amino acids 2 to 273 (272 residues), 412.6 bits, see alignment E=8.2e-128 PF01656: CbiA" amino acids 5 to 226 (222 residues), 36.7 bits, see alignment E=3.9e-13

Best Hits

Swiss-Prot: 86% identical to NIFH_DESAD: Nitrogenase iron protein (nifH) from Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)

KEGG orthology group: K02588, nitrogenase iron protein NifH [EC: 1.18.6.1] (inferred from 100% identity to dvu:DVUA0015)

MetaCyc: 75% identical to [MoFe]-nitrogenase complex nitrogenase reductase component monomer (Clostridium pasteurianum)
Nitrogenase. [EC: 1.18.6.1]

Predicted SEED Role

"Nitrogenase (molybdenum-iron) reductase and maturation protein NifH" in subsystem Nitrogen fixation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.6.1

Use Curated BLAST to search for 1.18.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WS4 at UniProt or InterPro

Protein Sequence (277 amino acids)

>DVUA0015 nitrogenase iron protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRKVAIYGKGGIGKSTTTQNTVAGLVDALGRKVMVVGCDPKADSTRLLLGGLAQKSVLDT
LRDEGEDVELDDIRKGGFGGTMCVESGGPEPGVGCAGRGIITSINMLESLGAYEEDQNLD
YVFYDVLGDVVCGGFAMPIRDGKAEEIYIVCSGEMMAMYAANNICKGIMKYAQSGVVRLG
GLICNSRNVDNEREMIEELARRLGTQMIYFVPRDNMVQRAEINRQTVIEYAPDHQQADHY
RNLARAIDGNEMFVIPKPLQVEDLESLLMEYGLLEAS