Protein Info for DVUA0024 in Desulfovibrio vulgaris Hildenborough JW710

Name: atoC
Annotation: sigma-54 interaction domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF00158: Sigma54_activat" amino acids 1 to 160 (160 residues), 215.4 bits, see alignment E=1.3e-67 PF14532: Sigma54_activ_2" amino acids 6 to 165 (160 residues), 64 bits, see alignment E=5.8e-21 PF07728: AAA_5" amino acids 17 to 136 (120 residues), 41.8 bits, see alignment E=3.3e-14 PF00004: AAA" amino acids 18 to 136 (119 residues), 21.4 bits, see alignment E=8.7e-08 PF25601: AAA_lid_14" amino acids 166 to 243 (78 residues), 65 bits, see alignment E=1.4e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0024)

Predicted SEED Role

"sigma-54 interaction domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WR5 at UniProt or InterPro

Protein Sequence (379 amino acids)

>DVUA0024 sigma-54 interaction domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRAQFETIARSSNADVNVLLQGETGTGKELFARAIHRMSQRRGGPLITVDCASLPEHLVE
SLLFGYSQGAFTGAAKSRVGLIRQADGGTLFLDEVSELPMSLQKKFLRVLQERRYRPVGG
GSEESSDFRLVAATNKDLQEMVREGTFRDDLLYRISTMRVLLPPLRERGLDIIEIAEHLL
QSRAESNGGKVWQMSAEFRARLLAHPWPGNVRELVNVIDCTLAVAGDGDMLFAEHLPATI
HAGMLPQSSRPWQGRTPARRSTDVGHHGMHDRAGKMAHGVANGAAPSHASHGPSQGPSHG
RQHDTADEAAAYATHVGGAHPDALPSFREARREALEAFEHAYLATLYEAVGGDIRQACSL
SNLSRTRLYELLRKHAIME