Protein Info for DVUA0041 in Desulfovibrio vulgaris Hildenborough JW710

Name: exeA
Annotation: conserved domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 TIGR03015: putative secretion ATPase, PEP-CTERM locus subfamily" amino acids 1 to 268 (268 residues), 427.2 bits, see alignment E=1.3e-132 PF13191: AAA_16" amino acids 39 to 155 (117 residues), 34.6 bits, see alignment E=4.2e-12 PF13401: AAA_22" amino acids 41 to 170 (130 residues), 101.1 bits, see alignment E=9.1e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0041)

Predicted SEED Role

"FIG022606: AAA ATPase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WP8 at UniProt or InterPro

Protein Sequence (439 amino acids)

>DVUA0041 conserved domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MYTAFFGFRVKPFDLLPNPDFLYPSRAYRKASAYLEYGVRDRAGFILITGEVGAGKTTLI
RSLLKRSLGDVLISKVFNTSVDAEQLVAMINDDFGLETDGRDKVAMLRDLNTFLIEQYAE
RRRPVLIIDEAQNLTPEVLEEVRMLSNLETDNAKLLQIILVGQPELRERIRSPQLLQLRQ
RILVQCHLEPLTREEVEEYVLYRLERAGNRDALHWEEGVMAEMHRATRGIPRLVNILGSY
VLLDAYAAGRRSISLPEMLDLLHSMDFDHQFWPTGTETEGEAGDETSPAVTGASAMTVTG
AAGGNGSHAAAAGAPVDMTPAPVGTAAQVPAGVAQTMTQTQAQATPAMLSLLQGLSRRVG
ELEQAHARMGENAYFDMLERQNELEQVLTRMAERVDRLHFAQAQRQVQVRQEQAAQERLA
AERAGNQRGGWLRRWFVGG