Protein Info for DVUA0046 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glycosyl transferase, group 2 family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 23 (4 residues), see Phobius details amino acids 363 to 379 (17 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details amino acids 450 to 469 (20 residues), see Phobius details PF13506: Glyco_transf_21" amino acids 89 to 217 (129 residues), 46.2 bits, see alignment E=4.4e-16 PF13641: Glyco_tranf_2_3" amino acids 95 to 261 (167 residues), 47.6 bits, see alignment E=2.7e-16 PF00535: Glycos_transf_2" amino acids 98 to 220 (123 residues), 78.7 bits, see alignment E=7.6e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0046)

Predicted SEED Role

"Glycosyl transferase, group 2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WP3 at UniProt or InterPro

Protein Sequence (482 amino acids)

>DVUA0046 glycosyl transferase, group 2 family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKTLFWLSSGLLAYAFVGYPLLLEAGSRLVRRTAARRAASPDVSPAAPSSARPSASMAAS
WHSAAQADAPSVRPSAGPSASSPDTARVIPDADLPTVSVLLSVFDEEAVIERKILNFLAL
DYPAERIELCVVSDGCTDATESIVARYAGQRVRLVRQEARGGKTRALNRAAAEAHGDVLV
FTDANAMFRPDCVRRLAERLADPGVGLVSGVSVYVHASGDTTAGGVYRRYEEWIKSRESD
LFSIVGADGAAYAMRRALYTPLAPEYINDLLHPVQVLLAGARAVSEPRAVVEEEVDAPVA
SPGSTQPGNTQPGSTSSGGRSSFGTSPGMQPGPQSRPRPQAQPDSQPDTGAEMRRQTRIM
AQSWLICLRQLPVLVRRGCWGFVWQMLSHKVLRWATLPLLAVCAVSAVALVPRGMPYALA
AAALAGGGLLAWAGARGLGGGRGWGGHARTAWLFVVLHAAAVNGLYRLLRGQTFVTWTPR
GD