Protein Info for DVUA0055 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 113 (17 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 215 to 241 (27 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details TIGR02602: exosortase" amino acids 34 to 273 (240 residues), 305 bits, see alignment E=3.7e-95 PF09721: Exosortase_EpsH" amino acids 36 to 266 (231 residues), 240 bits, see alignment E=1.2e-75 TIGR04178: exosortase/archaeosortase family protein" amino acids 179 to 270 (92 residues), 65.5 bits, see alignment E=4.3e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0055)

Predicted SEED Role

"Eight transmembrane protein EpsH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WN4 at UniProt or InterPro

Protein Sequence (317 amino acids)

>DVUA0055 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTLAATFRQQPLHLLPVIAMFAVTYHAIVMRMVGDWNFDPNYSHGFLVPCLALWFAWMRW
PELREAEVRPSAWGLGLLAAGLCLLVLGSVLIELFTSRASLVVLMMGTVLFLYGRDAFRI
LLFPLAYLLFMIPLPYTVYDALALPLKGLVSFAATGGIKLLGLPVLREGNVIIFPNITLE
VVDACSGLRSIMSLAALGTAFAFLFLPAGWRRWTLVLATVPIAVATNTLRVFVTGVLSWY
IGKDAARGFFHDFEGLVVFAVAMALTAALGFVLARVGRASARPDARPDAGPDAGPDAGPD
AGPGTGTGGTGGGAHVG