Protein Info for DVUA0057 in Desulfovibrio vulgaris Hildenborough JW710

Name: atoC
Annotation: sigma-54 dependent transcriptional regulator/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF00072: Response_reg" amino acids 5 to 117 (113 residues), 65.8 bits, see alignment E=1.4e-21 PF00158: Sigma54_activat" amino acids 169 to 335 (167 residues), 231.2 bits, see alignment E=2.1e-72 PF14532: Sigma54_activ_2" amino acids 170 to 340 (171 residues), 68.3 bits, see alignment E=3.1e-22 PF07728: AAA_5" amino acids 192 to 311 (120 residues), 30.4 bits, see alignment E=1.2e-10 PF25601: AAA_lid_14" amino acids 341 to 413 (73 residues), 75 bits, see alignment E=1.2e-24 PF02954: HTH_8" amino acids 435 to 470 (36 residues), 22.7 bits, see alignment 2.3e-08

Best Hits

KEGG orthology group: K02481, two-component system, NtrC family, response regulator (inferred from 100% identity to dvl:Dvul_3052)

Predicted SEED Role

"Response regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WN2 at UniProt or InterPro

Protein Sequence (476 amino acids)

>DVUA0057 sigma-54 dependent transcriptional regulator/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPGLLIVEDNEDVRRQLRWGLAKEPYDLHLAGSVDEALALQREHAPAVVTLDLGLPPDAE
GASEGFRGLAALLDHDPRTKVIVVTGHHDMENALRAIEGGAYDFCQKPADLEMLKVIISR
AFFLHGLQGGGAMASASGMASASGGASAPDAVSGAGAGGGKPDDGWQGIVGRCPSMRAVF
ETVAKVAVTGAPVLVTGESGTGKELVARAIHALGPRCTRTFVAINCGAIPDNLLEAEFFG
YEKGAFTGATQRVQGKVEYADGGTLFLDEIGELPANLQVKLLRFLQEKVIQRVGGRKDIA
VDARIVAATNRDIQTEIASGRFREDLYYRIGVVPVALPPLRARGDDILLLARHFLESSAG
EGTGNIVGFSPAAEQAMLRYAWPGNVRELENKVRRAVIFASGRRIMPDDLGFDETPAKAA
APRPEGSLREARNALERDMVLSALDKCGGNIVQASLAIGVSRPTFYDLLRKHGIEA