Protein Info for DVUA0090 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 33 to 50 (18 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 199 to 228 (30 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details PF04474: DUF554" amino acids 2 to 103 (102 residues), 63.2 bits, see alignment E=1.2e-21 amino acids 156 to 282 (127 residues), 118.4 bits, see alignment E=1.6e-38

Best Hits

KEGG orthology group: K07150, (no description) (inferred from 100% identity to dvu:DVUA0090)

Predicted SEED Role

"probable membrane protein yqgA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WJ9 at UniProt or InterPro

Protein Sequence (290 amino acids)

>DVUA0090 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTGPAINSACIVAGAVLGSLLARRVGSSFQKNIMLVFGCISTGLGIFMIGKAHAMPPIVC
SLMAGTVLGELFRLEHIVVRLSHKVAGFFARRSARRAARKAARMTAQAGANATVAASGAV
TGTVTGAADAGTPDAATPASPCAAPDAARPSVSIEAIQEQFAVFTVVFSASGLGFFGAMQ
EGLTGDFTMLLIKSLLDLPTAMFIAANIGAVIGVLCVPQFVIQMAVLLSAGFVSHWATPA
VLADFSGCGGFIMLATGLRMCGIVQFPILSMLPALLLAMPVSALWVHLIG