Protein Info for DVUA0093 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: chromate transport family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 143 to 175 (33 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 318 to 343 (26 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details PF02417: Chromate_transp" amino acids 11 to 175 (165 residues), 155.3 bits, see alignment E=7.5e-50 amino acids 242 to 439 (198 residues), 112.1 bits, see alignment E=1.5e-36 TIGR00937: chromate efflux transporter" amino acids 17 to 374 (358 residues), 215.6 bits, see alignment E=8e-68

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 100% identity to dvu:DVUA0093)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WJ6 at UniProt or InterPro

Protein Sequence (445 amino acids)

>DVUA0093 chromate transport family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDARQVPSFSEAFRTWLRIGLLGFGGPAGQIALMHKTLVEEKKWVDNERFLHALNYCHFL
PGPEAQQLATYVGWLLHRTWGGIVAGTLFILPGYCVIMALSILYAGYRQVPAVEALFYGL
KPAVLAIVIGAVLRMGRKSLRTPFAVCLAGMAFMALFAFRVPFPWVIGCAALLGWLKAGR
DRAAAPAGAAGAAVPGDAEPLPDHVHPDTGRSLRTLAMWSALWFIPVAASGWLAGWDSVY
AHIALFFSKMAVVTFGGAYAVLTYVAQQAVENYQWLSPGDMISGLALAETTPGPLILVLQ
YVGFMAAYAAPGALHPVVAGVLGGTLAVWVTFTPCFLWIFLGAPYMEKVRANKALSAAFA
GVTAAVVGVILNLSAWFGLHTLFTRVQDWDGPVGLLLPVPVLASFDAGAFALSAVAVFAM
TRFRLGMGVTLGLCALSGWAMKLLL