Protein Info for DVUA0098 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: dehydrogenase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00096, glycerol-1-phosphate dehydrogenase [NAD(P)] [EC: 1.1.1.261] (inferred from 100% identity to dvu:DVUA0098)

Predicted SEED Role

"Glycerol dehydrogenase (EC 1.1.1.6)" in subsystem Respiratory dehydrogenases 1 (EC 1.1.1.6)

MetaCyc Pathways

glycerol degradation V (2/2 steps found)
glycerol degradation II (1/2 steps found)
superpathway of glycerol degradation to 1,3-propanediol (1/4 steps found)
glycerol degradation to butanol (9/16 steps found)
C_20,20 CDP-archaeol biosynthesis (1/6 steps found)
C_25,25 CDP-archaeol biosynthesis (1/10 steps found)
archaetidylinositol biosynthesis (1/10 steps found)
archaetidylserine and archaetidylethanolamine biosynthesis (1/11 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

Glycerolipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.261 or 1.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WJ1 at UniProt or InterPro

Protein Sequence (349 amino acids)

>DVUA0098 dehydrogenase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNRATYISVPGLVRIKPGALARLGVYLRRGGYVRVAVLASTGLPQPVVEAVRGGFAQEGV
EAASWAEVADNTFEEVVHDFAALPAKVGAIVGLGGGKALDMAKYMAFLAGVPYFAAPTSL
SNDGFCSPQASLTLNGRRRSLAARLPQGVVIDVDVCLSAPRILWLSGVGDLASKLSAVVD
WKLAFHNTGEPVNDLAALLSDATVRQFMAAPAFDAQGMSLLGTALMLNGIAMEICASSRP
ASGSEHLVSHALDATASRPRLHGLQVGVATYLMRRLQRQETATIDRLFTKTGFWDAIRAD
PFSKAEWLEAVRVAPSVKDDFFTVLSLRDCLPEVRAMLDDDPVLAGCFV