Protein Info for DVUA0101 in Desulfovibrio vulgaris Hildenborough JW710

Name: flhB
Annotation: type III secretion protein, hrpY/hrcU family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details TIGR01404: type III secretion protein, YscU/HrpY family" amino acids 2 to 342 (341 residues), 374.6 bits, see alignment E=2.6e-116 PF01312: Bac_export_2" amino acids 3 to 340 (338 residues), 393 bits, see alignment E=6.2e-122

Best Hits

KEGG orthology group: K03229, type III secretion protein SctU (inferred from 100% identity to dvl:Dvul_3011)

Predicted SEED Role

"Type III secretion inner membrane protein (YscU,SpaS,EscU,HrcU,SsaU, homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WI8 at UniProt or InterPro

Protein Sequence (346 amino acids)

>DVUA0101 type III secretion protein, hrpY/hrcU family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSDKTEQPTPKRLREAREKGDICKSQDIGSAVTVLAVAGYFAFAGESIFASLMEVTELSM
RHMAMPFDEALPLLGTAVVHAAVGIVLPVVGLAMMAAFLGTLAQTGVLFAFKGAMPKLEN
ISPGKWFKKVFSMRNAVELLKNCIKVGVLGWAVWKVMSDHMRGLFSIPDGDIGLLLKVLG
TAARDMVLMAAVVFCVIAALDYLYQRWQYNKQHMMTKDEVKREYKEMEGDPHIKGKRKQL
HQEMLAQNTLSNVRKAKVIVTNPTHFAVALDYEKDRTPLPVILAKGEGLMARRMVEIARE
EGIPVMQNVPLARSLFAEGTENAYIPKELIGPVAEVLRWVQSLQER