Protein Info for DVUA0109 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: type III secretion system chaperone, LcrH/SycD family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR02552: type III secretion low calcium response chaperone LcrH/SycD" amino acids 25 to 161 (137 residues), 156.6 bits, see alignment E=1.5e-50 PF07720: TPR_3" amino acids 45 to 74 (30 residues), 21.4 bits, see alignment 2.3e-08

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_3001)

Predicted SEED Role

"Type III secretion chaperone protein for YopD (SycD)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WI0 at UniProt or InterPro

Protein Sequence (166 amino acids)

>DVUA0109 type III secretion system chaperone, LcrH/SycD family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTSYQHSGPEFTEAQMQAMVDGLFAGASIGAVCNMQQEQLEAGYALAYNLYTAGNYRDA
ETMFRALCVYDHNDERYWLGLAGCRQAQGDLAGAIDAYGLAGAASALGDPAPFVHAGICY
MKLGDTENARNTFAGVPFIGDPDNDTHAAMHRKAEAMLELLAGERP