Protein Info for DVUA0122 in Desulfovibrio vulgaris Hildenborough JW710

Name: yscR
Annotation: type III secretion system protein, YscR family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details TIGR01102: type III secretion apparatus protein, YscR/HrcR family" amino acids 10 to 211 (202 residues), 257.1 bits, see alignment E=5.9e-81 PF00813: FliP" amino acids 13 to 211 (199 residues), 220.2 bits, see alignment E=1.2e-69

Best Hits

Swiss-Prot: 52% identical to PRO2_XANCG: Pathogenicity-related ORF2 from Xanthomonas campestris pv. glycines

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 100% identity to dvu:DVUA0122)

Predicted SEED Role

"Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WG7 at UniProt or InterPro

Protein Sequence (216 amino acids)

>DVUA0122 type III secretion system protein, YscR family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTGVAPLYFIAGMALLGLAPFFLMMVTSYVKIVVVTSLVRNALGVQQVPPTMVMNGLAII
LSIFIMAPVASGTLDLMQNMKIGPDPAPREIIALLDKASPPLRGFLERNADDKVVTVFMS
TAKRIWPADQHASISRDNLLILIPSFTISELTRAFQIGFLLYLPFVAIDLVISNILLAMG
MMMVSPMTISLPFKLLLFVTLDGWLKVSQGLLLSYR