Protein Info for DVU0640 in Desulfovibrio vulgaris Hildenborough JW710

Name: pomA
Annotation: chemotaxis protein PomA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 59 (25 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details PF01618: MotA_ExbB" amino acids 101 to 212 (112 residues), 100 bits, see alignment E=4.3e-33

Best Hits

Swiss-Prot: 45% identical to POMA_VIBAL: Chemotaxis protein PomA (pomA) from Vibrio alginolyticus

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to dvu:DVU0640)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ED8 at UniProt or InterPro

Protein Sequence (250 amino acids)

>DVU0640 chemotaxis protein PomA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDIATLIGIVGGFALIIIAILLGGSLMPFVDIPSVVIVIGGTITAILVMFPLEVVLGSMG
IAMRTFKFNKENPVQTVEDICKLADTARRESLVALEKVPLQDEFLKKGIRMVADGSSQDQ
VTALLDAEINFMKQRHRRGQAVFKGLGSAAPAFGMIGTLVGLVNMLQNLSDPASIGPAMA
VALLTTFYGAVLSNLMFLPMAKKLEERSFDEQFMMQLKMEGVLSILNGEHPQLVKEKLMA
FLPPNLRPKE