Protein Info for DVU0639 in Desulfovibrio vulgaris Hildenborough JW710

Name: pomB
Annotation: chemotaxis protein PomB (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details PF13677: MotB_plug" amino acids 26 to 71 (46 residues), 61.2 bits, see alignment 5.8e-21 PF00691: OmpA" amino acids 145 to 239 (95 residues), 49.4 bits, see alignment E=5e-17

Best Hits

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 100% identity to dvl:Dvul_2320)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ED9 at UniProt or InterPro

Protein Sequence (257 amino acids)

>DVU0639 chemotaxis protein PomB (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAEPTQAPPPPPPRRGGDDGGDGGGGDIPEWIVTFADMMSLLLCFFILLLSFAKTDIAKF
QAALGSIQDAFGVQRERPQDIEAAFSPTTESQVLITEKLDAAEQEQLEVARMLKELVNEQ
AEIAKNAIISAEEGGINLRVNSRALFEPGSARLLPDGEAVIRLVHTILLKHKYDLIVEGH
TGSREPFSSQFPTHWELSAARAVTLVRHILSLGVSPRRLKAVGYGDTRPLVPENDDTGEL
NRRVEFFFRPQSANPHL