Protein Info for DVU0628 in Desulfovibrio vulgaris Hildenborough JW710

Name: buk
Annotation: butyrate kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR02707: butyrate kinase" amino acids 13 to 369 (357 residues), 398.5 bits, see alignment E=1.2e-123 PF00871: Acetate_kinase" amino acids 159 to 324 (166 residues), 40.9 bits, see alignment E=5.4e-15

Best Hits

Swiss-Prot: 59% identical to BUK_DESAG: Probable butyrate kinase (buk) from Desulfovibrio alaskensis (strain G20)

KEGG orthology group: K00929, butyrate kinase [EC: 2.7.2.7] (inferred from 100% identity to dvu:DVU0628)

Predicted SEED Role

"Butyrate kinase (EC 2.7.2.7)" in subsystem Acetyl-CoA fermentation to Butyrate or Isoleucine degradation or Valine degradation (EC 2.7.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EF0 at UniProt or InterPro

Protein Sequence (372 amino acids)

>DVU0628 butyrate kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSASQRHDRGAERILVINPGSTTTKVALFEGEVPLFDETVEHGKESLRAFPAVTDQFAFR
LRAVKDVLEHHGVLDTPLDAVAGRGGLLAPMQGGTWRVGPAMLATLAEARHGEHPCNLGA
ALARHFADLHGVEAYIVDPVVTDEMDDVARYTGLPQIRRRSVFHALSHRAAARVAASRCG
VAYEEGRFLVAHMGGGVSVAAHRCGRIVDVVNALDGDGPITAERTGRLPVLPVLDLIERG
LQTFESMRRIVLREGGLWAHCGTNDLREVERRMETGDAAAAAIFDALAYTIAKELASLAP
AVLGTARGGVTTVTAVVLTGGMARSVRLTSRLEAHLGWLGPMVVLPDVEEMRALTQGVLR
VLRGEEVAKEYV