Protein Info for DVU0627 in Desulfovibrio vulgaris Hildenborough JW710

Name: ptB
Annotation: phosphotransbutyrylase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to PTB_CLOAB: Phosphate butyryltransferase (ptb) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

KEGG orthology group: K00634, phosphate butyryltransferase [EC: 2.3.1.19] (inferred from 100% identity to dvu:DVU0627)

MetaCyc: 45% identical to phosphotransbutyrylase subunit (Clostridium acetobutylicum)
Phosphate butyryltransferase. [EC: 2.3.1.19]

Predicted SEED Role

No annotation

MetaCyc Pathways

superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
pyruvate fermentation to butanoate (3/7 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

Butanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EF1 at UniProt or InterPro

Protein Sequence (343 amino acids)

>DVU0627 phosphotransbutyrylase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSVLQAGTATETPRTSDAGRQNEGADGAVAAPRTLDDIVAAVVRRGIPVRVAVAACAEPN
ALAAVLEARDMGMAVPVLVGDIAATESIATERGLSLEGCEVEDEPVPVKAVQRAVDRVRT
GGADVLMKGLVNTDVLLRVVLNRVSGLSAGGLLSHVAVCSLPATCGGEASASSRLVCITD
AAVNISPNMERKLGIVRNAICVARSLGIPSPRVAMLAATEKVMLPAMPATLDAQIVARMA
DQGEFGDAMVAGPMALDVAISPDIAARKGVSHPVAGRADILCAPDIESGNILYKSLTTLA
HVEMAGILTGTTAPVVVPSRGDSRRSKLLSLALAAYVAMECRL