Protein Info for DVU0624 in Desulfovibrio vulgaris Hildenborough JW710

Name: nrfH
Annotation: NapC/NirT cytochrome c family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF03264: Cytochrom_NNT" amino acids 13 to 96 (84 residues), 53.9 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 100% identical to NRFH_DESVH: Cytochrome c nitrite reductase subunit NrfH (DVU_0624) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_2334)

Predicted SEED Role

"Cytochrome c nitrite reductase, small subunit NrfH" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EF4 at UniProt or InterPro

Protein Sequence (159 amino acids)

>DVU0624 NapC/NirT cytochrome c family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSEEKSRNGPARLKLVLGGATLGVVALATVAFGMKYTDQRPFCTSCHIMNPVGVTHKLSG
HANISCNDCHAPHNLLAKLPFKAIAGARDVYMNTLGHPGDLILAGMETKEVVNANCKACH
TMTNVEVASMEAKKYCTDCHRNVQHMRMKPISTREVADE