Protein Info for DVU0612 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: STAS domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 155 to 174 (20 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 226 to 249 (24 residues), see Phobius details amino acids 288 to 317 (30 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details PF01740: STAS" amino acids 36 to 109 (74 residues), 29.9 bits, see alignment E=4e-11 TIGR00056: ABC transport permease subunit" amino acids 150 to 397 (248 residues), 240.5 bits, see alignment E=1.2e-75 PF02405: MlaE" amino acids 186 to 394 (209 residues), 247.1 bits, see alignment E=1.4e-77

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to dvu:DVU0612)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EG6 at UniProt or InterPro

Protein Sequence (401 amino acids)

>DVU0612 STAS domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPHVPQQLDAPSLAREEDPRGITENGSRLPDVLLESFGNTGILRFSGAWDVATAARARGQ
LQHLAIPAECGDLTFDLTGVLRLDTAGALVITTFRTALEKQGIAPLLHCAPAHNALIDRV
AAIDMSEAPTVRHASALARTLNAIGASIVEETEQAVGILAFMGMLVISLVGLVLRPWRFR
WVSLCSHMEQTGVQAVPIVALLSFLIGLVTAYMGAEQFARFGAQVFVINLLEISTLREMG
VLLTALVVAGRSGSSFTAQIGAMVANEEVSAMRALGLDPIEVLVVPRVLALVVMLPILAF
IADIMGILGGGVAAWGTLGIDPANFTARFHEIVHLRNFVVGMIKAPFFALVIALVGCFQG
FRVTGSAESVGRLTTQAVVEAIFMVIVLNALFAILFTSLGV