Protein Info for DVU0606 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: transcriptional regulator, ArsR family/methyltransferase, UbiE/COQ5 family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF12840: HTH_20" amino acids 11 to 60 (50 residues), 32.1 bits, see alignment 4.7e-11 PF01022: HTH_5" amino acids 13 to 58 (46 residues), 47.7 bits, see alignment 5.6e-16 PF12802: MarR_2" amino acids 16 to 62 (47 residues), 29.1 bits, see alignment 4.6e-10 PF00891: Methyltransf_2" amino acids 109 to 247 (139 residues), 23.4 bits, see alignment E=1.8e-08 PF01209: Ubie_methyltran" amino acids 111 to 260 (150 residues), 53.4 bits, see alignment E=1.2e-17 PF13489: Methyltransf_23" amino acids 148 to 284 (137 residues), 52.6 bits, see alignment E=2.2e-17 PF13847: Methyltransf_31" amino acids 148 to 251 (104 residues), 63.8 bits, see alignment E=7.9e-21 PF08241: Methyltransf_11" amino acids 150 to 244 (95 residues), 81.5 bits, see alignment E=2.8e-26 PF13649: Methyltransf_25" amino acids 150 to 241 (92 residues), 71.1 bits, see alignment E=5.4e-23 PF08242: Methyltransf_12" amino acids 150 to 243 (94 residues), 53.2 bits, see alignment E=2.2e-17

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 100% identity to dvl:Dvul_2348)

Predicted SEED Role

"Predicted regulator of methionine metabolism, ArsR family" in subsystem Methionine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EH2 at UniProt or InterPro

Protein Sequence (307 amino acids)

>DVU0606 transcriptional regulator, ArsR family/methyltransferase, UbiE/COQ5 family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSLALQYFKALSDETRLRLIHVLNRHELSVNELVSILEMGQSRVSRHLKILTGAGLLTSR
RDGLWVFYSAAAEGDGRAFLDAVTPFVTTDMVLQADLDMAQKIIEERALKTRQFFNAIAE
DWDELNREVLGGFDLAGAVAEAMPQCETAVDLGCGTGSVIERMLQRSQQVIGVDGSPRML
ELARRRFVEGAERVSLRIGELDHLPLRDGEADFASINMVLHHLSDPGVALGEIRRVLRLG
GQLMVTDFDRHDNERMRSDYGDRWLGFEGVQLEGLLREAGFTVRECRRQGVAKGLALHLM
LAEKTQQ