Protein Info for DVU0600 in Desulfovibrio vulgaris Hildenborough JW710

Name: ldh
Annotation: L-lactate dehydrogenase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00056: Ldh_1_N
  • amino acids 3 to 140 (138 residues), 128.2 bits, E=2.5e-41
• TIGR01771: L-lactate dehydrogenase
  • amino acids 6 to 302 (297 residues), 349.4 bits, E=8.9e-109
• PF02866: Ldh_1_C
  • amino acids 143 to 305 (163 residues), 125.9 bits, E=1.8e-40

Best Hits

Swiss-Prot: 100% identical to LDH_DESVH: L-lactate dehydrogenase (ldh) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 100% identity to dvu:DVU0600)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.1.27)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.27)

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• Bifidobacterium shunt (13/15 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (7/8 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• L-histidine degradation V (1/2 steps found)
• methylglyoxal degradation V (1/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See P62051 at UniProt or InterPro

Protein Sequence (309 amino acids)

>DVU0600 L-lactate dehydrogenase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNRIAVIGVGNVGMAFAYAAAIKRLANDIVLIDANAARAEGESMDLADAMALVGPVQIRS
GGYEQCEGARIVVVTAGAKQMPGQSRLDLVRVNAGITRDILTAVMQYADDPLYIMATNPV
DVLTHVARTVTGVAPGRVIGSGTVLDSARFRGHVAEILGVDVRGVHAHIVGEHGDSEVAL
WSRANVSGIPVAEMCARRGIAYDAAFREKALGHVRHAAYEIIGRKGATGYGIGMSLCRIV
EAILHDEHSVLTVSCPVAGHYGLGDVSLSLPCVIGSDGIEEVLDAPIAEDEQAALAASAR
VLGEHLAAL