Protein Info for DVU0597 in Desulfovibrio vulgaris Hildenborough JW710

Name: lytS
Annotation: regulatory protein LytS (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 31 to 188 (158 residues), 168.4 bits, see alignment E=3.3e-53 PF01590: GAF" amino acids 232 to 345 (114 residues), 23.8 bits, see alignment E=1.7e-08 PF13492: GAF_3" amino acids 236 to 346 (111 residues), 29.5 bits, see alignment E=2.7e-10 PF06580: His_kinase" amino acids 360 to 438 (79 residues), 88.1 bits, see alignment E=1.2e-28 PF02518: HATPase_c" amino acids 457 to 559 (103 residues), 54 bits, see alignment E=6.6e-18

Best Hits

KEGG orthology group: K07704, two-component system, LytT family, sensor histidine kinase LytS [EC: 2.7.13.3] (inferred from 100% identity to dvu:DVU0597)

Predicted SEED Role

"Sensor protein lytS (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EI1 at UniProt or InterPro

Protein Sequence (571 amino acids)

>DVU0597 regulatory protein LytS (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFITLSERFGLLLAGGFAIMTLAPLDKLGPGRTRSWRATALLVVLFSLFTILGTYNGNIV
FQSFANLRAMGAVTAGLFGGPMVGALTGLIAGGHRYFIDVGGFSAVPCGLATFLEGLAAG
LFAWRFPSRSLDWGTAMTFAAVGEAVHMCLVLGLARPYAQAVDLVEVIGLPMILLNGVGA
AIFVQALRMQMHFRDLRDSSQARQILSIANRTLPHLRAGLSAASARATAEIILDETRVAA
VALTSNDMVMAHVGAASDHHRAGHSVCTQATRRVATDGIPLFVTGHDEIGCQLEACPLCS
AIIVPLRKGDTILGCLKLYGTKDRPLDQTLFELAKGLADLFATQIELEDIGIKNQLLARA
EIRRLQAQINPHFLFNSLNTVASFCRTAPGQARELILDLARYMRRNLDTSREAIHLAEEV
EQIRAYLVIEKARFGERIRAVIDIDPETEHCLVPPLLIQPLVENSVRHGILGNEEGGVVR
LATSMEDGHVVVVVEDDGAGMPESTRQGILNGTPVTAHGEGIGASNCNQRLVQLYGPAYA
LSIDSAPGMGTRITFRVPASTDAEVFASAAA