Protein Info for DVU0596 in Desulfovibrio vulgaris Hildenborough JW710

Name: lytR
Annotation: DNA-binding response regulator LytR (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00072: Response_reg" amino acids 6 to 111 (106 residues), 67.7 bits, see alignment E=1e-22 PF04397: LytTR" amino acids 156 to 255 (100 residues), 74.5 bits, see alignment E=6.5e-25

Best Hits

KEGG orthology group: K02477, two-component system, LytT family, response regulator (inferred from 100% identity to dvu:DVU0596)

Predicted SEED Role

"DNA-binding response regulator LytR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EI2 at UniProt or InterPro

Protein Sequence (257 amino acids)

>DVU0596 DNA-binding response regulator LytR (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTIRALVVDDERPARDELVYLLSAHADVETMEAASAGEALSLIASHHPDLVFQDIEMPGR
GGFDVLQAASLMTNPPVFVFVTAFDQHAIRAFDENAADYLLKPVAPERLARCLERVRQRL
APDGGSTQVEDMMDRLLARIGRERPLPRIAVEQGGRIHLVPTPEVVLIEAEEKRIAVVTE
AGRFTCHGAQSLARIEDRLAGQPFFRANRAVLVNLERVAEFSPWYNGKYHLVMNDSERTG
VTVSRNRVRDFKQALGV