Protein Info for DVU0594 in Desulfovibrio vulgaris Hildenborough JW710

Name: iciA
Annotation: chromosome initiation inhibitor (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 TIGR03298: transcriptional regulator, ArgP family" amino acids 3 to 292 (290 residues), 404.6 bits, see alignment E=1.1e-125 PF00126: HTH_1" amino acids 5 to 62 (58 residues), 63.9 bits, see alignment E=1e-21 PF03466: LysR_substrate" amino acids 108 to 272 (165 residues), 43.2 bits, see alignment E=3.1e-15

Best Hits

Swiss-Prot: 40% identical to ARGP_AERSA: HTH-type transcriptional regulator ArgP (argP) from Aeromonas salmonicida

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 100% identity to dvu:DVU0594)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EI4 at UniProt or InterPro

Protein Sequence (300 amino acids)

>DVU0594 chromosome initiation inhibitor (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MYDYRQVEAVAAVVLEGSFEKAAARLHITQSAVSQRVKALEDSLGRMLVVRASPVRATDE
GQRIVEHYLKVGQLEADLGASLVTDRPAAWTTLPVAINADSLATWFLDAVGPLLRRERVL
LDIVTEDQEHTYRLLREGRVAACITTRADPVQGWRSLALGDMPSLCLATPEFAARWFSEG
LTPAAVREAPAVLYNRKDSLHHRFLSDLFEEEVDFPAHYVPSSERFVDVLAGGFAYGIVP
ALQAERHLADGVLCDLAPGRAVSVHLYWHCWSLTTRFVEELTENVVSHARAVLGWRVPAR