Protein Info for DVU0582 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 91 to 106 (16 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details PF17203: sCache_3_2" amino acids 40 to 173 (134 residues), 62.4 bits, see alignment E=2e-20 TIGR00229: PAS domain S-box protein" amino acids 300 to 420 (121 residues), 66.7 bits, see alignment E=1.1e-22 PF00989: PAS" amino acids 305 to 403 (99 residues), 36 bits, see alignment E=2.5e-12 PF13188: PAS_8" amino acids 305 to 364 (60 residues), 34.7 bits, see alignment 4.7e-12 PF08448: PAS_4" amino acids 310 to 416 (107 residues), 23.5 bits, see alignment E=2.3e-08 PF13426: PAS_9" amino acids 314 to 416 (103 residues), 39.3 bits, see alignment E=2.6e-13 PF00512: HisKA" amino acids 433 to 500 (68 residues), 39 bits, see alignment E=2.8e-13 PF02518: HATPase_c" amino acids 547 to 660 (114 residues), 90.7 bits, see alignment E=3.4e-29 PF14501: HATPase_c_5" amino acids 550 to 644 (95 residues), 22 bits, see alignment E=5.1e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2370)

Predicted SEED Role

"multi-sensor signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EJ6 at UniProt or InterPro

Protein Sequence (672 amino acids)

>DVU0582 sensory box histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MILRRFHKLGLQKKFFFTILVVIMAISGTIALLARWILVSSLTDELQMRGTAIAHSVAAR
GAGFILDGDTPQLVGLIFDEAQLRERTQLVAYIYVLDTSDALLAHTFIRPFPSHLKAANP
LPEGAARSMELVRVHGREAYDIAVPVREGLYQIGTVHVGLNKAHMDSLVGKLRVTFLGFI
TAVVIITFIISHYLARYITAPVSRLTNISDDLSRGNFNTAVDLDMPDQGWNILDCPAYSD
TDLPCWHFDDQRHARTSPEHLHRCRTCVFYRKRQGDEVIQLADSFRNMVWSIKLYRKRLQ
ESEGKYRSLFDSGPDPIFVVDCERGTILDANPRAVEQYGYAREELVGLSFEKLGGDAMRE
CPRLFDEDSSPTGCVHLPKVAQYHKDGSTFWVNLHACPISYRARPAIIVSTTDITEMLEK
DAQIVQAAKMKSLGEMSAGVAHELNQPLNAIRMGSDYLNMALEQGLPVPPEQLREVTLDI
CGQVDRATEIINTLRSFGRKSEILEEPVNLNAPVRSVLLLVEHQFLLQNVEFELHLGDAL
PPVKAHNNRLQQVVFNIITNARDAVIERMRRDAGLRGRITITTSHEGDTVTLSVKDNGCG
IPATLREQVFQPFFTTKATGQGMGLGLAIVYGIVRSYGGDIRIDGVPTGGTEFSLTFPTT
TEDGTEQRRPVA