Protein Info for DVU0580 in Desulfovibrio vulgaris Hildenborough JW710

Name: moaA
Annotation: molybdenum cofactor biosynthesis protein A (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 12 to 341 (330 residues), 373.4 bits, see alignment E=4.4e-116 PF04055: Radical_SAM" amino acids 26 to 186 (161 residues), 111.9 bits, see alignment E=5.6e-36 PF13353: Fer4_12" amino acids 28 to 116 (89 residues), 26 bits, see alignment E=1.5e-09 PF06463: Mob_synth_C" amino acids 191 to 317 (127 residues), 116.5 bits, see alignment E=1.2e-37

Best Hits

Swiss-Prot: 56% identical to MOAA_DESAD: GTP 3',8-cyclase (moaA) from Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to dvu:DVU0580)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EJ8 at UniProt or InterPro

Protein Sequence (341 amino acids)

>DVU0580 molybdenum cofactor biosynthesis protein A (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNHYDDRPASSLVDLHGRRVRYLRLSVTDRCNLRCLYCWGGGGMRFIPHDDILRYEEMAR
LVDVAVESGVEKVRLTGGEPLVRKNVLHLVELVRKKHPAIDLRITTNGTLLESHVAGLRD
LGVSTVNVSLDTFRREVFHEVTGRDFLPQVMAGMEAVLAAGLSLKVNAVALRGVNDGELA
TFVDFARNHRVDVRFIEFMPMGCGTRWNDANFWPADDILARVHDLADLRPVVPDKGGRGP
ARLFDIVGGQGRFGVITPMSDHFCGDCNRLRVTSDGRLRTCLFADREYRLRPLLRHPKLG
VEAVRRVIALANRRKPLGFRLLERMRPGLAVAERRMTAIGG