Protein Info for DVU0577 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: formate dehydrogenase formation protein FdhE, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF04216: FdhE" amino acids 11 to 288 (278 residues), 113.2 bits, see alignment E=1.1e-36

Best Hits

KEGG orthology group: K02380, FdhE protein (inferred from 100% identity to dvu:DVU0577)

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EK1 at UniProt or InterPro

Protein Sequence (293 amino acids)

>DVU0577 formate dehydrogenase formation protein FdhE, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSYDVDDALKRLERKLKALRAKNYIPDSLLEIVARTAAMQADARARVSVALPEGLATPDA
HVQGAPLLARDAFPYDRAVTAQLFGRLLAMLHAAGGSLGMSADAFKARLEAGEVTLEALC
DAMLRDDEAFFEAWAGKMPEAPSLVRFLALGSLVPSLEAVASLLALNHDPESVWQHGHCP
LCGSAPLISRIAGKEGARYSTCSFCRHEYRTARLQCPFCLETAAEKLEYFTADGEPGYQV
HVCRSCDSYIKLADFREYDRESIPVLDDLESLALDILARQQGFSRPTASAWGF