Protein Info for DVU0569 in Desulfovibrio vulgaris Hildenborough JW710

Name: flrA
Annotation: sigma-54 dependent transcriptional regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 TIGR00229: PAS domain S-box protein" amino acids 81 to 197 (117 residues), 24.3 bits, see alignment E=2.9e-09 PF13188: PAS_8" amino acids 85 to 134 (50 residues), 25.6 bits, see alignment 3.1e-09 PF00989: PAS" amino acids 87 to 189 (103 residues), 31 bits, see alignment E=8e-11 PF08448: PAS_4" amino acids 91 to 191 (101 residues), 29.4 bits, see alignment E=2.7e-10 PF00158: Sigma54_activat" amino acids 210 to 376 (167 residues), 222.7 bits, see alignment E=8.5e-70 PF14532: Sigma54_activ_2" amino acids 228 to 381 (154 residues), 42.7 bits, see alignment E=2.6e-14 PF25601: AAA_lid_14" amino acids 382 to 447 (66 residues), 80.2 bits, see alignment E=3e-26 TIGR04381: TyrR family helix-turn-helix domain" amino acids 476 to 522 (47 residues), 35 bits, see alignment 1.1e-12 PF18024: HTH_50" amino acids 476 to 522 (47 residues), 49.7 bits, see alignment 8.1e-17

Best Hits

KEGG orthology group: K03721, transcriptional regulator of aroF, aroG, tyrA and aromatic amino acid transport (inferred from 100% identity to dvl:Dvul_2382)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EK9 at UniProt or InterPro

Protein Sequence (526 amino acids)

>DVU0569 sigma-54 dependent transcriptional regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKLKLELVFKDRVGIVSDVSSLLAGEGYSIVCMEVERRHDRSHVHIEADGAGEGAFAALR
QRFESMRGLLECREVQTLPAEERENRIKVVLDTIGDGVMSIDGGGRITSINKVAREAYGC
AGEDVTERSLTSLRLPDHGLLDCLHGRELHDARRELATPLGRLQFFVTRTPIRDGVGRII
GAVEIARDMREIRKLARTLVDADHVGFDDIVGHHPAIEAAIAFARRVAATDAVIAIRGES
GTGKELFARAMHAESGRKGPFVPINCAALPEQLLESELFGYERGAFTGGRREGKPGLFES
ARGGTVFLDEIGDMPLASQAKILRVMQEQRVRRIGGEAEVPVDARIITATNRPLERMVED
GRFRQDLYYRINVLPMHIPPLRERRGDIPLLANHFLQQLASRIGGAAPAFTDGALARLRS
HEWPGNVRELKNVVERAAILAGGAVVDDQFILFSHELGKGVFNAARTASAAGQGDTLKEQ
VANFEKKIVEDVVRRAPSIRKAAKILGISHTALLDKMRRHGVILEE