Protein Info for DVU0566 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: GAF domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF13185: GAF_2" amino acids 22 to 160 (139 residues), 54 bits, see alignment E=3.3e-18 PF01590: GAF" amino acids 23 to 159 (137 residues), 51.4 bits, see alignment E=2.6e-17 PF13492: GAF_3" amino acids 26 to 161 (136 residues), 41.1 bits, see alignment E=3.3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0566)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EL2 at UniProt or InterPro

Protein Sequence (185 amino acids)

>DVU0566 GAF domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MASQDFFRALWGVATVINSSLDTGTVLDKITEQTATALNCKASTIRLLDRTRKVLLASAA
YGLSDGYMRKGPVEVAKSGMDGEVLAGKTIHLRDACSDGRFQYPSAAKSEGLTSVLSTPL
IVGGKAIGILRVYSATERDFTNEEEDFMKAVASISAIAIENARLHEALRADYEIVSKYNV
RIFEE