Protein Info for DVU0556 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ISDvu3, transposase OrfA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 87 PF01527: HTH_Tnp_1" amino acids 1 to 70 (70 residues), 63.8 bits, see alignment E=2.7e-21 PF13384: HTH_23" amino acids 14 to 45 (32 residues), 31.1 bits, see alignment E=3.2e-11 PF13518: HTH_28" amino acids 20 to 44 (25 residues), 27.1 bits, see alignment E=6.9e-10

Best Hits

Swiss-Prot: 43% identical to YIA3_RHISP: Insertion element ISR1 uncharacterized 10 kDa protein A3 from Rhizobium sp.

KEGG orthology group: None (inferred from 98% identity to dba:Dbac_1156)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EM1 at UniProt or InterPro

Protein Sequence (87 amino acids)

>DVU0556 ISDvu3, transposase OrfA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKKGRFSEEQMVGILREADRSPVAQVAKKHGISEQTIYTWRQRFAGMSADDVKRLRLLEQ
ENTRLKKILAERDLEIEVMKEIATKKW