Protein Info for DVU0554 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: NAD-dependent epimerase/dehydratase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF05368: NmrA" amino acids 7 to 122 (116 residues), 30.4 bits, see alignment E=1.1e-10 PF04321: RmlD_sub_bind" amino acids 7 to 229 (223 residues), 35.4 bits, see alignment E=2.3e-12 PF01370: Epimerase" amino acids 7 to 241 (235 residues), 185.9 bits, see alignment E=2.9e-58 PF16363: GDP_Man_Dehyd" amino acids 8 to 301 (294 residues), 138.8 bits, see alignment E=1e-43 PF02719: Polysacc_synt_2" amino acids 8 to 261 (254 residues), 34.4 bits, see alignment E=5e-12 PF01073: 3Beta_HSD" amino acids 8 to 230 (223 residues), 77.2 bits, see alignment E=4.1e-25 PF13460: NAD_binding_10" amino acids 10 to 157 (148 residues), 50.9 bits, see alignment E=6.4e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0554)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EM3 at UniProt or InterPro

Protein Sequence (312 amino acids)

>DVU0554 NAD-dependent epimerase/dehydratase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSFRACVLGASGFLGSHLVHHLLKAGCQVHAFSRDSRRNPLLTDELMSSCSIFTGDFFN
TQDVERALADCDVCFHLVSTTIPKTSNDDPLRDVRENLSGSLTLLECVRRTGVRKVVYAS
SGGAIYGKHLMPRISENHPTDPLCSYGIVKLAVEKYLALYHELYGIDYAALRISNPFGPL
QRTSAEQGVIGVFLGKILRNEPLHVWGDGSVVRDYIYVEDVARALVLAARLNTEHHVFNI
GSGAGLSLNDIIDMMRSVTGRDVVVKYDQNRVFDVPYSVLDVSLAERELGWRALFPFKVG
VSLAWVWLCENS