Protein Info for DVU0549 in Desulfovibrio vulgaris Hildenborough JW710

Updated annotation (from data): proline/arginine ABC transporter, permease component
Rationale: Specific phenotype: utilization of L-Arginine, L-Proline
Original annotation: high-affinity branched-chain amino acid ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 193 to 209 (17 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 328 to 355 (28 residues), see Phobius details amino acids 367 to 384 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 112 to 378 (267 residues), 172.2 bits, see alignment E=6.3e-55

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to dvl:Dvul_2395)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EM8 at UniProt or InterPro

Protein Sequence (407 amino acids)

>DVU0549 proline/arginine ABC transporter, permease component (Desulfovibrio vulgaris Hildenborough JW710)
MQGIIKSLQVGLWFMFLTFPLMVIRVDTLNGTVDWRWQNMVMMGLGTFALSFLWRYMLAR
KEAGGASARQGNAAAGGLMARVRSDARLRTPALLAVLVVFAVLPMLVSTYQTNIMISALL
YVMLGLGLNIVVGLSGQLVLGYVAFYAVGAYAYALLNADFGLGFWTVLPIGGALAAVFGI
LLGFPVLRLKGDYLAIVTLGFGEIVRLVLENWGSVTRGPSGISKIARPGLFGMELSVSEA
TTYIYYLILAAVIFTIFAVGRLKDSRIGRAWQALREDEIACEAMGIDLTTTKLTAFALGA
CWAGFAGVIFAAKTTFINPASFTFLESAMILAMVVLGGMGSTLGVVLGALVLILLPEYLR
AFSEYRMLIFGAAMVLMMVFRPQGLVSCRSREYDVNDPEAGKSGEKA