Protein Info for DVU0540 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensor histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 803 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 227 to 252 (26 residues), see Phobius details PF11845: Tll0287-like" amino acids 48 to 212 (165 residues), 114.3 bits, see alignment E=1.3e-36 PF00512: HisKA" amino acids 582 to 642 (61 residues), 55.4 bits, see alignment 1.1e-18 PF02518: HATPase_c" amino acids 688 to 792 (105 residues), 91 bits, see alignment E=1.4e-29 PF14501: HATPase_c_5" amino acids 694 to 784 (91 residues), 22.7 bits, see alignment E=1.7e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0540)

Predicted SEED Role

"periplasmic sensor signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EN7 at UniProt or InterPro

Protein Sequence (803 amino acids)

>DVU0540 sensor histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPSAPPENGHRRHKPYSLQIRFMLGLMGILVTMGLFFAASLYMHLNQLVSAEARSKASLI
LSHAESVQSYVRNTLRPAMYRDLPADRFIIEAMSTSFVTRHVMSDPAHGNEAFEYRRVAI
DARNPSFEAASLERGLIERFKADPTLTRIEETENGERGERFITARPVRFEEACMKCHGAP
EDAPPQLIALYGPVRGFGRSPGELAGIDLVSIAIDESLSSAKEAITSFATLFAVGMVILF
AIIHTFFTRLVVYNLRRMGAAMQRQLGFDANGSMLDRLRRDEEIEDVINTMEGFTRQLAQ
ARQQLKDYASNLESMVATRTADLQAEADARSADVGLFVELLAGLNRSQGKHDLLGTSLEL
IARRFNAASAAYACLLSGTESFSWPADAAPPQLPEDMGVLLGDGLPRLTPRAWYIPVQTT
ETSRGLLCLFWREDRPHGPRTPELAQALGRQLGIALDNIDVLDNLLRQNTLLDSIFEGIS
DPLLLLDGHGAIVFANGSAERMAKAIPGGLPRLLDDAGLPDAVAEPAQMEIALEDGRSFV
INVYPLAQTHGRNRSVVYLRETTREKRMFDQMRQQEKLASVGRLAAGLAHEINNPLGVIM
CYAELLQTQVGDSQARHDLDIILRHTLQAQRVVRDLLDFARPKDTRCEACDINDVLSDIV
EIFMPKARKSGVNVSLDLEPDLPRVYADRDSLGQVFSNLLLNALDAVPERTGTIAISTCG
KGYGVTVTIRDNGPGIPEAHRDRIFDPFYTTKETGRGTGLGLAVVYGIMRDLNGNIDVST
DDGATFILHFPADGDPRDHANDM