Protein Info for DVU0536 in Desulfovibrio vulgaris Hildenborough JW710

Name: hmcA
Annotation: HmcA; high-molecular-weight cytochrome c (voordouw)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details PF02085: Cytochrom_CIII" amino acids 75 to 154 (80 residues), 32.1 bits, see alignment E=2.4e-11 amino acids 190 to 263 (74 residues), 34.2 bits, see alignment E=5.6e-12 amino acids 296 to 397 (102 residues), 62.6 bits, see alignment E=7.7e-21 amino acids 490 to 555 (66 residues), 33.2 bits, see alignment E=1.1e-11 PF14522: Cytochrome_C7" amino acids 77 to 155 (79 residues), 25.5 bits, see alignment E=1.9e-09

Best Hits

Swiss-Prot: 100% identical to HMWC_DESVH: High-molecular-weight cytochrome c (hmcA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0536)

MetaCyc: 100% identical to Hmc complex A subunit (Desulfovibrio vulgaris)

Predicted SEED Role

"High-molecular-weight cytochrome c precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P24092 at UniProt or InterPro

Protein Sequence (560 amino acids)

>DVU0536 HmcA; high-molecular-weight cytochrome c (voordouw) (Desulfovibrio vulgaris Hildenborough JW710)
MSEDVYHPFFQRTATMRNGRTLLRWAGVLAATAIIGVGGFWSQGTTKALPEGPGEKRADL
IEIGAMERFGKLDLPKVAFRHDQHTTAVTGMGKDCAACHKSKDGKMSLKFMRLDDNSAAE
LKEIYHANCIGCHTDLAKAGKKTGPQDGECRSCHNPKPSAASSWKEIGFDKSLHYRHVAS
KAIKPVGDPQKNCGACHHVYDEASKKLVWGKNKEDSCRACHGEKPVDKRPALDTAAHTAC
ISCHMDVAKTKAETGPVNCAGCHAPEAQAKFKVVREVPRLDRGQPDAALILPVPGKDAPR
EMKGTMKPVAFDHKAHEAKANDCRTCHHVRIDTCTACHTVNGTADSKFVQLEKAMHQPDS
MRSCVGCHNTRVQQPTCAGCHGFIKPTKSDAQCGVCHVAAPGFDAKQVEAGALLNLKAEQ
RSQVAASMLSARPQPKGTFDLNDIPEKVVIGSIAKEYQPSEFPHRKIVKTLIAGIGEDKL
AATFHIEKGTLCQGCHHNSPASLTPPKCASCHGKPFDADRGDRPGLKAAYHQQCMGCHDR
MKIEKPANTACVDCHKERAK