Protein Info for DVU0533 in Desulfovibrio vulgaris Hildenborough JW710

Name: hmcD
Annotation: HmcD, 5.8 kd protein in hmc operon (voordouw)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 47 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details PF28260: sulf_resp_HmcD" amino acids 5 to 42 (38 residues), 81.6 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 100% identical to HMC4_DESVH: Protein DVU_0533 (DVU_0533) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2408)

MetaCyc: 100% identical to Hmc complex D subunit (Desulfovibrio vulgaris)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33391 at UniProt or InterPro

Protein Sequence (47 amino acids)

>DVU0533 HmcD, 5.8 kd protein in hmc operon (voordouw) (Desulfovibrio vulgaris Hildenborough JW710)
MDQAIYTLHEFMLHTKNWTYILMGVTLLVYVGYWLFLTGRDEKIRKY