Protein Info for DVU0512 in Desulfovibrio vulgaris Hildenborough JW710

Name: flgF
Annotation: flagellar basal-body rod protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 138 (135 residues), 135.7 bits, see alignment E=3.1e-43 amino acids 149 to 237 (89 residues), 79.2 bits, see alignment E=4.9e-26 TIGR02490: flagellar basal-body rod protein FlgF" amino acids 7 to 236 (230 residues), 198.9 bits, see alignment E=7.9e-63 PF00460: Flg_bb_rod" amino acids 17 to 35 (19 residues), 22.7 bits, see alignment (E = 1.2e-08) PF22692: LlgE_F_G_D1" amino acids 99 to 162 (64 residues), 58.7 bits, see alignment E=8e-20 PF06429: Flg_bbr_C" amino acids 211 to 253 (43 residues), 65.3 bits, see alignment 4.2e-22

Best Hits

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 100% identity to dvu:DVU0512)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EQ7 at UniProt or InterPro

Protein Sequence (260 amino acids)

>DVU0512 flagellar basal-body rod protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQDSMLSGLFGALTTEHRLNNIANNLANVNTNGYKRDVLAFKDTMALFAHDEIMEPMANV
RSKKLFPEPLHVARPRIAVARTDFSQGSFHYTSDPLDLAISGNGFFKVRTPEGEFYTRNG
HFRQTSDGQLVTMQGWPVLSEGGDINLPQGKNLQVASDGRIAVDGVDVGQLQVVTVSDLE
GLEKLGGNLYRLREGSTAGEVPVGPDVIVSQGYIETSNVEVVNEMVNMIETQRQFEAYQK
VMQTSDTVDRDAITKIGRGR