Protein Info for DVU0505 in Desulfovibrio vulgaris Hildenborough JW710

Name: truB
Annotation: tRNA pseudouridine synthase B (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 6 to 212 (207 residues), 194.2 bits, see alignment E=1.1e-61 PF01509: TruB_N" amino acids 28 to 175 (148 residues), 161.6 bits, see alignment E=1.7e-51

Best Hits

Swiss-Prot: 100% identical to TRUB_DESVH: tRNA pseudouridine synthase B (truB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 100% identity to dvl:Dvul_2436)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ER4 at UniProt or InterPro

Protein Sequence (304 amino acids)

>DVU0505 tRNA pseudouridine synthase B (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPVQQHGLLVLDKPSGPSSAQCISKVKRLGQKKIGHAGTLDPMAGGVLLVLLGHATKISG
HLMADGEKVYAGTLRLGETTDTWDAEGTVTATAPWHHVTEADVRAIVDSWLGSSEQEVPP
YSAAKHQGQPLYKLSRAGRETPVKTKTVEISLAEVVWCDLPHVRFRVRCSSGTYIRSLAH
SLGIRLGCGAVLTELTREYSHPFGLDMAHTLDAVLAEPGRLAERVIPITHALPHWPKVGI
SLQQEASVRNGIPLPYQPEMVADMPFMEGVKAILLDTREVPVALVETAIVGGRQVWAVLR
GLWS