Protein Info for DVU0494 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: aminotransferase, class V (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0494)

MetaCyc: 37% identical to serine--glyoxylate transaminase (Synechocystis sp. PCC 6803)
Phosphoserine transaminase. [EC: 2.6.1.52]

Predicted SEED Role

"Serine--glyoxylate aminotransferase (EC 2.6.1.45)" in subsystem Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.6.1.45)

MetaCyc Pathways

superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (9/12 steps found)
L-serine biosynthesis II (3/4 steps found)
superpathway of L-serine and glycine biosynthesis I (3/4 steps found)
pyridoxal 5'-phosphate biosynthesis I (5/7 steps found)
L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)
L-serine biosynthesis I (2/3 steps found)
photorespiration I (6/9 steps found)
photorespiration III (6/9 steps found)
photorespiration II (6/10 steps found)
formaldehyde assimilation I (serine pathway) (7/13 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.45

Use Curated BLAST to search for 2.6.1.45 or 2.6.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ES5 at UniProt or InterPro

Protein Sequence (389 amino acids)

>DVU0494 aminotransferase, class V (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLNKPRLLTPGPTPLPERVRLVMAQDMIHHRKPAFKKLMGEVQEKLRILFGTSQPVLPLA
CSGSGAMTAAVHGLFVPGEKVIVVEGGKFGQRWREIASLRGLEVVSIVVEWGRAVSLAEV
EAALDAHPDAKGVLMQLSETSTGVLHPVRGIAAVTRKRDVLLVADGISAVGISPCPMDEW
GVDCLLTGSQKGLMLPPGLALIALSERAWRKADTVAPSCFYFNLPGERANCEKGQTLFTT
PVSLIVGLGESLDMFLEAGLETVYRKQWALTMLARAGTAALGLAPLAPERFTWGLTSVML
PAGVDGTRLLQVAADNHGVVMAGGQDHLKGRILRIGHMGWVDWADIVAGLHAVASGLRTC
GAYVGARDYIETGLAAYEAALQVAPGTPV