Protein Info for DVU0492 in Desulfovibrio vulgaris Hildenborough JW710

Name: argC
Annotation: N-acetyl-gamma-glutamyl-phosphate reductase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 4 to 354 (351 residues), 390.8 bits, see alignment E=3e-121 PF01118: Semialdhyde_dh" amino acids 6 to 146 (141 residues), 100.5 bits, see alignment E=1.3e-32 PF22698: Semialdhyde_dhC_1" amino acids 154 to 322 (169 residues), 188.4 bits, see alignment E=1.3e-59 PF02774: Semialdhyde_dhC" amino acids 167 to 324 (158 residues), 77.2 bits, see alignment E=2.8e-25

Best Hits

Swiss-Prot: 49% identical to ARGC_MOOTA: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Moorella thermoacetica (strain ATCC 39073 / JCM 9320)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 100% identity to dvl:Dvul_2449)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ES7 at UniProt or InterPro

Protein Sequence (354 amino acids)

>DVU0492 N-acetyl-gamma-glutamyl-phosphate reductase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQTIRAGLVGVTGYTGMELARLLAGHPAMRLVLATSRAEAGRRLDDIYPFLIGLPGGDIT
IVAPDPDVIAASCDIAFLAVPHGAAMEMAASLRERGLRVVDLSADFRLRDVTVYESWYRT
DHTRKGLLPEAVYGLPELYGKDVAQAGLVANPGCYPTSVILGLAAALDTDIVHRDDIVID
AKSGASGAGRKAAVGSLFCEVHDSFKAYNLGKHRHTPEIEQELSVIAGEALTVSFNTHLL
PIDRGILSTMYLRMKKPLDLDTVHAMYADYWAAHQTRGGWVRLLPKGRLPETRHVKGTMF
CDIGLVVDPRTGRLIVVSAIDNLCRGASGQAVANANIMLGLPVDAGLRLAPLMP