Protein Info for DVU0491 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HDIG domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF11871: DUF3391" amino acids 2 to 130 (129 residues), 82.6 bits, see alignment E=5.9e-27 TIGR00277: HDIG domain" amino acids 159 to 253 (95 residues), 31 bits, see alignment E=8.8e-12 PF01966: HD" amino acids 161 to 283 (123 residues), 72.9 bits, see alignment E=4.2e-24 PF13487: HD_5" amino acids 170 to 311 (142 residues), 102.6 bits, see alignment E=3.3e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2450)

Predicted SEED Role

"HDIG domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ES8 at UniProt or InterPro

Protein Sequence (401 amino acids)

>DVU0491 HDIG domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLKKIGTVELKPGMFVVDTGISWLENPYLYAHEGLVGSESDVRRIRDEGYLEVFIDTRRS
LFGRDPDGVSDEEILSGALQQLEDPGVLEPQVPVAEEMRKATVLYDTTVRYARGIMDEMR
DKGVVDMSEAEPLVDSMLGSITRNTNALVGLAKLRNVDEYTYTHCINVGLLSMVFGRHLG
FGPVTLARLGLAGLFHDLGKARIPDDILKSPRRLSPDEFEVMKGHPGIGFEYMRERGGVP
EEVLEGVYEHHEKHNGLGYPRGLRGEQISVAGRILAVVDVYDALTSRRVYKEPMLPHKAL
SLMYGMRGQDFSPGLVERFIRCLGIYPVGSVVELNTGQRCVVSEANLRNPLQPRVLIVHD
SKGRPCSPRPLDLAGQTAVRIATCLDPVGVGIDPGRALGAM