Protein Info for DVU0482 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box histidine kinase/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 PF00072: Response_reg" amino acids 10 to 112 (103 residues), 88.9 bits, see alignment E=6.5e-29 TIGR00229: PAS domain S-box protein" amino acids 137 to 262 (126 residues), 26 bits, see alignment E=4.3e-10 PF00989: PAS" amino acids 139 to 228 (90 residues), 28.2 bits, see alignment E=4.1e-10 PF13188: PAS_8" amino acids 139 to 194 (56 residues), 25.6 bits, see alignment 2.2e-09 PF08448: PAS_4" amino acids 145 to 258 (114 residues), 29.1 bits, see alignment E=2.5e-10 PF08447: PAS_3" amino acids 161 to 251 (91 residues), 42.2 bits, see alignment E=2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0482)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ET6 at UniProt or InterPro

Protein Sequence (482 amino acids)

>DVU0482 sensory box histidine kinase/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQNGTTPPHILTVEDDESLRASVVAWLEDAGYTVSEAGDAHRALEIIQRGPPDLILLDLG
IPGISGEDLLAMLNDRHPGLPVVVVSGRADIGDAIAAFRLGAWDYLTKPLPDLDMLGVTI
TNCLERKRLRTLLHSAEMRYQELVHHLPVLVFALDEGLNLTFINNSVRSLLGWSAHEALA
VPGWFVANLHPDDAPQVRAAFTQALRSPAGAFGLEFRFMHSGGYPVPLQARFTYEPSPRP
DSGMPGRIEGVLVDLTERMFIERLLGQQTRLNTLAAVTDEVAHEFRNPVFALAGFARALK
RRCPEAPEADVILEEAAKLEGLIDGIHARLMPVAHPHRPCRLDEVAGFCVDMMRPIAMRR
AFRLGFEAAPDLPPVVTDEDLVAQLLLALLTTAFDNGSPGGLTQIAIHPGEGGQRLTVSF
PPATTHAQAEVDDVSGYARSLAVAYRLASRLGFALTTDKDDGTTSFILDVPEHPVTTPES
RQ