Protein Info for DVU0479 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: serine/threonine protein kinase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 PF00069: Pkinase" amino acids 6 to 222 (217 residues), 121.7 bits, see alignment E=7.4e-39 PF07714: PK_Tyr_Ser-Thr" amino acids 12 to 217 (206 residues), 65 bits, see alignment E=1.4e-21 PF07603: Lcl_C" amino acids 378 to 491 (114 residues), 69 bits, see alignment E=8.7e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0479)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ET9 at UniProt or InterPro

Protein Sequence (499 amino acids)

>DVU0479 serine/threonine protein kinase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKIGRYEVCGLLGRGGMGVVYKVRQPVTGRVAALKLLKPADILVDLAGMDALREGFLHEA
TVMASLDHPHVAAVWDVDEAGGLPFFVMEYYCLNLGLLMGESYRVEAPTRRLPLERAVRY
ARQTLEALRRMHHEGIVHRDVKPFNIMVTGDDAVKLIDFGLSRLRGETRLSPRGVKVGSP
YYAPPEQESAPDAVDARADLYPVGVMLFRMLTGVLPTDEERMKDGRIPRASALSDELDEG
WDAFFDTAMAADPARRFPDAASMLAALARCEAAWRKQVEATCRLIPEQAAGPGDASDMRH
DAGHESVQAGQTDETGQAGQAGQAGQAVTCEGAPAASGGVRCRPVKVGVHEARATFALDA
LWRPASAARQGLEARDDGTVSHAATGLQWETGGCDFPLTRDEAEAYVEARNALRFAGHDD
WRLPTVDELLTLVDAGVTVGDPCVASVFAPLPDPLWTSDRKSYMASWFVSAAMGFVGWQD
DTCRFGVRLVRGGSARCRE