Protein Info for DVU0467 in Desulfovibrio vulgaris Hildenborough JW710

Name: trpD
Annotation: anthranilate phosphoribosyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF02885: Glycos_trans_3N" amino acids 6 to 67 (62 residues), 58.8 bits, see alignment E=3.8e-20 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 9 to 330 (322 residues), 338.7 bits, see alignment E=2.1e-105 PF00591: Glycos_transf_3" amino acids 76 to 325 (250 residues), 258 bits, see alignment E=1.1e-80

Best Hits

Swiss-Prot: 75% identical to TRPD_DESVM: Anthranilate phosphoribosyltransferase (trpD) from Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 99% identity to dvl:Dvul_2470)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EV1 at UniProt or InterPro

Protein Sequence (332 amino acids)

>DVU0467 anthranilate phosphoribosyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTAIATILETLATGCDLHPEMAGAGFASLMDGDMTPAQAGSFLMGLRMKGETADEMTEAV
RAALARAVTVRGVDAPSIDIVGTGGDGRSSFNCSTATALTLAGMGHKVVKHGNRAVSSSC
GSADAIEGLGLPLEVDAADVPAMLHERGFAFLFAPRFHPAFRHVMPIRRELGVRTLFNLL
GPLLNPARPTHMLLGVARESLMPLMAETLRRTGAARAAVVFGAGGYDELTPLGPARVLFL
RDGIVSEHEVDPARYGIAPCTPEDLVVRDREEAVRVLRELLSGAGPQAMRDMLVFNVGMA
LHLLHDDRPLEDCMNEARRAVHAGAGRKVLHA