Protein Info for DVU0464 in Desulfovibrio vulgaris Hildenborough JW710

Updated annotation (from data): prephenate and/or arogenate dehydrogenase
Rationale: important for fitness in defined media, and rescued by added tyrosine. This is the second or third step in tyrosine synthesis from chorismate via prephenate; it is not clear if dehydrogenation or transamination occurs first.
Original annotation: prephenate dehydrogenase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K04517, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 100% identity to dvl:Dvul_2473)

Predicted SEED Role

"Prephenate and/or arogenate dehydrogenase (unknown specificity) (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

superpathway of aromatic amino acid biosynthesis (17/18 steps found)
superpathway of L-tyrosine biosynthesis (9/10 steps found)
L-tyrosine biosynthesis I (3/3 steps found)
L-tyrosine biosynthesis III (2/4 steps found)
4-hydroxy-3-prenylbenzoate biosynthesis (1/4 steps found)
superpathway of novobiocin biosynthesis (4/19 steps found)
superpathway of chorismate metabolism (31/59 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EV4 at UniProt or InterPro

Protein Sequence (255 amino acids)

>DVU0464 prephenate and/or arogenate dehydrogenase (Desulfovibrio vulgaris Hildenborough JW710)
MKIALVGDKGRMGRLLTSRFSAAGCEVAGVDRPLTPDTVRPAVQGADVVILCVPVEVLAE
VLSIVAPLLSPKQVLADITSVKVRPMEVMQAFHAGPVVGTHPLFGPDPQDDHLPVAVTPG
SSARDADVTLVEQCFRMIGCDTFRTTAQEHDRAAAMIQGLNFISSVAYLATLAHNEELLP
FVTPSFRRRLDAARKMLTEDAALFEGMFEANPASQDAVRSFRSFLNIASAGDVDVLVDRA
RWWWRTHDDRGGARQ